Anti MKLN1 pAb (ATL-HPA022817)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022817-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MKLN1
Alternative Gene Name: TWA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025609: 96%, ENSRNOG00000054514: 96%
Entrez Gene ID: 4289
Uniprot ID: Q9UL63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP |
| Gene Sequence | QAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP |
| Gene ID - Mouse | ENSMUSG00000025609 |
| Gene ID - Rat | ENSRNOG00000054514 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MKLN1 pAb (ATL-HPA022817) | |
| Datasheet | Anti MKLN1 pAb (ATL-HPA022817) Datasheet (External Link) |
| Vendor Page | Anti MKLN1 pAb (ATL-HPA022817) at Atlas Antibodies |
| Documents & Links for Anti MKLN1 pAb (ATL-HPA022817) | |
| Datasheet | Anti MKLN1 pAb (ATL-HPA022817) Datasheet (External Link) |
| Vendor Page | Anti MKLN1 pAb (ATL-HPA022817) |
| Citations for Anti MKLN1 pAb (ATL-HPA022817) – 2 Found |
| Debenedittis, Paige; Harmelink, Cristina; Chen, Yunjia; Wang, Qin; Jiao, Kai. Characterization of the novel interaction between muskelin and TBX20, a critical cardiogenic transcription factor. Biochemical And Biophysical Research Communications. 2011;409(2):338-43. PubMed |
| Boldt, Karsten; van Reeuwijk, Jeroen; Lu, Qianhao; Koutroumpas, Konstantinos; Nguyen, Thanh-Minh T; Texier, Yves; van Beersum, Sylvia E C; Horn, Nicola; Willer, Jason R; Mans, Dorus A; Dougherty, Gerard; Lamers, Ideke J C; Coene, Karlien L M; Arts, Heleen H; Betts, Matthew J; Beyer, Tina; Bolat, Emine; Gloeckner, Christian Johannes; Haidari, Khatera; Hetterschijt, Lisette; Iaconis, Daniela; Jenkins, Dagan; Klose, Franziska; Knapp, Barbara; Latour, Brooke; Letteboer, Stef J F; Marcelis, Carlo L; Mitic, Dragana; Morleo, Manuela; Oud, Machteld M; Riemersma, Moniek; Rix, Susan; Terhal, Paulien A; Toedt, Grischa; van Dam, Teunis J P; de Vrieze, Erik; Wissinger, Yasmin; Wu, Ka Man; Apic, Gordana; Beales, Philip L; Blacque, Oliver E; Gibson, Toby J; Huynen, Martijn A; Katsanis, Nicholas; Kremer, Hannie; Omran, Heymut; van Wijk, Erwin; Wolfrum, Uwe; Kepes, François; Davis, Erica E; Franco, Brunella; Giles, Rachel H; Ueffing, Marius; Russell, Robert B; Roepman, Ronald. An organelle-specific protein landscape identifies novel diseases and molecular mechanisms. Nature Communications. 2016;7( 27173435):11491. PubMed |