Anti MKI67IP pAb (ATL-HPA035735)

Atlas Antibodies

Catalog No.:
ATL-HPA035735-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nucleolar protein interacting with the FHA domain of MKI67
Gene Name: NIFK
Alternative Gene Name: NIFK, hNIFK, Nopp34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026377: 48%, ENSRNOG00000025701: 43%
Entrez Gene ID: 84365
Uniprot ID: Q9BYG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Gene Sequence IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Gene ID - Mouse ENSMUSG00000026377
Gene ID - Rat ENSRNOG00000025701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MKI67IP pAb (ATL-HPA035735)
Datasheet Anti MKI67IP pAb (ATL-HPA035735) Datasheet (External Link)
Vendor Page Anti MKI67IP pAb (ATL-HPA035735) at Atlas Antibodies

Documents & Links for Anti MKI67IP pAb (ATL-HPA035735)
Datasheet Anti MKI67IP pAb (ATL-HPA035735) Datasheet (External Link)
Vendor Page Anti MKI67IP pAb (ATL-HPA035735)