Anti MIS18BP1 pAb (ATL-HPA006504)

Atlas Antibodies

Catalog No.: ATL-HPA006504-25

Protein Description: MIS18 binding protein 1
Gene Name: MIS18BP1
Alternative Gene Name: C14orf106, FLJ11186, KIAA1903, KNL2, M18BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047534: 57%, ENSRNOG00000023093: 61%
Entrez Gene ID: 55320
Uniprot ID: Q6P0N0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHQRILLPSFQDSEDDDDILPNMDKNPTTPSSVIFPLVKTPQCQHVSPGMLGSINRNDCDKYVFRMQKYHKSNGGIVWGNIKKKLVETDFSTPTPRRKTPFNTDLGENSGIGKLFTNAVESLDE
• Gene Sequence: QHQRILLPSFQDSEDDDDILPNMDKNPTTPSSVIFPLVKTPQCQHVSPGMLGSINRNDCDKYVFRMQKYHKSNGGIVWGNIKKKLVETDFSTPTPRRKTPFNTDLGENSGIGKLFTNAVESLDE
• Gene ID - Mouse: ENSMUSG00000047534
• Gene ID - Rat: ENSRNOG00000023093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.