Anti MIS12 pAb (ATL-HPA044482)

Atlas Antibodies

Catalog No.:
ATL-HPA044482-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MIS12 kinetochore complex component
Gene Name: MIS12
Alternative Gene Name: hMIS12, KNTC2AP, MGC2488, MTW1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040599: 76%, ENSRNOG00000007725: 79%
Entrez Gene ID: 79003
Uniprot ID: Q9H081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEIEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKI
Gene Sequence KEIEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKI
Gene ID - Mouse ENSMUSG00000040599
Gene ID - Rat ENSRNOG00000007725
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIS12 pAb (ATL-HPA044482)
Datasheet Anti MIS12 pAb (ATL-HPA044482) Datasheet (External Link)
Vendor Page Anti MIS12 pAb (ATL-HPA044482) at Atlas Antibodies

Documents & Links for Anti MIS12 pAb (ATL-HPA044482)
Datasheet Anti MIS12 pAb (ATL-HPA044482) Datasheet (External Link)
Vendor Page Anti MIS12 pAb (ATL-HPA044482)