Anti MIER1 pAb (ATL-HPA019589 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019589-25

Protein Description: mesoderm induction early response 1, transcriptional regulator
Gene Name: MIER1
Alternative Gene Name: hMI-ER1, KIAA1610, MI-ER1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028522: 97%, ENSRNOG00000007175: 96%
Entrez Gene ID: 57708
Uniprot ID: Q8N108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEI
• Gene Sequence: MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEI
• Gene ID - Mouse: ENSMUSG00000028522
• Gene ID - Rat: ENSRNOG00000007175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MIER1 pAb (ATL-HPA019589 w/enhanced validation) – 1 Found

Lakisic, Goran; Lebreton, Alice; Pourpre, Renaud; Wendling, Olivia; Libertini, Emanuele; Radford, Elizabeth J; Le Guillou, Morwenna; Champy, Marie-France; Wattenhofer-Donzé, Marie; Soubigou, Guillaume; Ait-Si-Ali, Slimane; Feunteun, Jean; Sorg, Tania; Coppée, Jean-Yves; Ferguson-Smith, Anne C; Cossart, Pascale; Bierne, Hélène. Role of the BAHD1 Chromatin-Repressive Complex in Placental Development and Regulation of Steroid Metabolism. Plos Genetics. 2016;12(3):e1005898.