Anti MIEF2 pAb (ATL-HPA042334)

Atlas Antibodies

Catalog No.: ATL-HPA042334-25

Protein Description: mitochondrial elongation factor 2
Gene Name: MIEF2
Alternative Gene Name: MGC23130, MiD49, SMCR7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018599: 71%, ENSRNOG00000028208: 69%
Entrez Gene ID: 125170
Uniprot ID: Q96C03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
• Gene Sequence: PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
• Gene ID - Mouse: ENSMUSG00000018599
• Gene ID - Rat: ENSRNOG00000028208
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.