Anti MID1IP1 pAb (ATL-HPA038816)

Atlas Antibodies

Catalog No.: ATL-HPA038816-25

Protein Description: MID1 interacting protein 1
Gene Name: MID1IP1
Alternative Gene Name: FLJ10386, G12-like, MIG12, STRAIT11499, THRSPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008035: 83%, ENSRNOG00000003228: 83%
Entrez Gene ID: 58526
Uniprot ID: Q9NPA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
• Gene Sequence: CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
• Gene ID - Mouse: ENSMUSG00000008035
• Gene ID - Rat: ENSRNOG00000003228
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MID1IP1 pAb (ATL-HPA038816) – 1 Found

Wang, Qifei; Yang, Junlin; Lin, Xiang; Huang, Zifang; Xie, Chaofan; Fan, Hengwei. Spot14/Spot14R expression may be involved in MSC adipogenic differentiation in patients with adolescent idiopathic scoliosis. Molecular Medicine Reports. 2016;13(6):4636-42.