Anti MICAL1 pAb (ATL-HPA030175)

Atlas Antibodies

Catalog No.: ATL-HPA030175-25

Protein Description: microtubule associated monooxygenase, calponin and LIM domain containing 1
Gene Name: MICAL1
Alternative Gene Name: DKFZp434B1517, FLJ11937, FLJ21739, MICAL, NICAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019823: 55%, ENSRNOG00000000307: 53%
Entrez Gene ID: 64780
Uniprot ID: Q8TDZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLFLSKLQRTLQRSRAKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLER
• Gene Sequence: VLFLSKLQRTLQRSRAKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLER
• Gene ID - Mouse: ENSMUSG00000019823
• Gene ID - Rat: ENSRNOG00000000307
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.