Anti MGME1 pAb (ATL-HPA040913)

Atlas Antibodies

Catalog No.: ATL-HPA040913-25

Protein Description: mitochondrial genome maintenance exonuclease 1
Gene Name: MGME1
Alternative Gene Name: bA504H3.4, C20orf72, DDK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027424: 62%, ENSRNOG00000028196: 62%
Entrez Gene ID: 92667
Uniprot ID: Q9BQP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLVQSVLSSRGVAQTPGSVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVL
• Gene Sequence: NLVQSVLSSRGVAQTPGSVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVL
• Gene ID - Mouse: ENSMUSG00000027424
• Gene ID - Rat: ENSRNOG00000028196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MGME1 pAb (ATL-HPA040913) – 5 Found

Nicholls, Thomas J; Zsurka, Gábor; Peeva, Viktoriya; Schöler, Susanne; Szczesny, Roman J; Cysewski, Dominik; Reyes, Aurelio; Kornblum, Cornelia; Sciacco, Monica; Moggio, Maurizio; Dziembowski, Andrzej; Kunz, Wolfram S; Minczuk, Michal. Linear mtDNA fragments and unusual mtDNA rearrangements associated with pathological deficiency of MGME1 exonuclease. Human Molecular Genetics. 2014;23(23):6147-62. 

Moretton, Amandine; Morel, Frédéric; Macao, Bertil; Lachaume, Philippe; Ishak, Layal; Lefebvre, Mathilde; Garreau-Balandier, Isabelle; Vernet, Patrick; Falkenberg, Maria; Farge, Géraldine. Selective mitochondrial DNA degradation following double-strand breaks. Plos One. 12(4):e0176795. 

Peeva, Viktoriya; Blei, Daniel; Trombly, Genevieve; Corsi, Sarah; Szukszto, Maciej J; Rebelo-Guiomar, Pedro; Gammage, Payam A; Kudin, Alexei P; Becker, Christian; Altmüller, Janine; Minczuk, Michal; Zsurka, Gábor; Kunz, Wolfram S. Linear mitochondrial DNA is rapidly degraded by components of the replication machinery. Nature Communications. 2018;9(1):1727. 

Kornblum, Cornelia; Nicholls, Thomas J; Haack, Tobias B; Schöler, Susanne; Peeva, Viktoriya; Danhauser, Katharina; Hallmann, Kerstin; Zsurka, Gábor; Rorbach, Joanna; Iuso, Arcangela; Wieland, Thomas; Sciacco, Monica; Ronchi, Dario; Comi, Giacomo P; Moggio, Maurizio; Quinzii, Catarina M; DiMauro, Salvatore; Calvo, Sarah E; Mootha, Vamsi K; Klopstock, Thomas; Strom, Tim M; Meitinger, Thomas; Minczuk, Michal; Kunz, Wolfram S; Prokisch, Holger. Loss-of-function mutations in MGME1 impair mtDNA replication and cause multisystemic mitochondrial disease. Nature Genetics. 2013;45(2):214-9. 

Szczesny, Roman J; Hejnowicz, Monika S; Steczkiewicz, Kamil; Muszewska, Anna; Borowski, Lukasz S; Ginalski, Krzysztof; Dziembowski, Andrzej. Identification of a novel human mitochondrial endo-/exonuclease Ddk1/c20orf72 necessary for maintenance of proper 7S DNA levels. Nucleic Acids Research. 2013;41(5):3144-61.