Anti MGAT2 pAb (ATL-HPA043721)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043721-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MGAT2
Alternative Gene Name: GNT-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043998: 83%, ENSRNOG00000004234: 84%
Entrez Gene ID: 4247
Uniprot ID: Q10469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH |
| Gene Sequence | PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH |
| Gene ID - Mouse | ENSMUSG00000043998 |
| Gene ID - Rat | ENSRNOG00000004234 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MGAT2 pAb (ATL-HPA043721) | |
| Datasheet | Anti MGAT2 pAb (ATL-HPA043721) Datasheet (External Link) |
| Vendor Page | Anti MGAT2 pAb (ATL-HPA043721) at Atlas Antibodies |
| Documents & Links for Anti MGAT2 pAb (ATL-HPA043721) | |
| Datasheet | Anti MGAT2 pAb (ATL-HPA043721) Datasheet (External Link) |
| Vendor Page | Anti MGAT2 pAb (ATL-HPA043721) |