Anti MGAT2 pAb (ATL-HPA043721)

Atlas Antibodies

Catalog No.:
ATL-HPA043721-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
Gene Name: MGAT2
Alternative Gene Name: GNT-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043998: 83%, ENSRNOG00000004234: 84%
Entrez Gene ID: 4247
Uniprot ID: Q10469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH
Gene Sequence PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH
Gene ID - Mouse ENSMUSG00000043998
Gene ID - Rat ENSRNOG00000004234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MGAT2 pAb (ATL-HPA043721)
Datasheet Anti MGAT2 pAb (ATL-HPA043721) Datasheet (External Link)
Vendor Page Anti MGAT2 pAb (ATL-HPA043721) at Atlas Antibodies

Documents & Links for Anti MGAT2 pAb (ATL-HPA043721)
Datasheet Anti MGAT2 pAb (ATL-HPA043721) Datasheet (External Link)
Vendor Page Anti MGAT2 pAb (ATL-HPA043721)