Anti MGAM pAb (ATL-HPA002270 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002270-25

Protein Description: maltase-glucoamylase (alpha-glucosidase)
Gene Name: MGAM
Alternative Gene Name: MGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068587: 67%, ENSRNOG00000026177: 68%
Entrez Gene ID: 8972
Uniprot ID: O43451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP
• Gene Sequence: VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP
• Gene ID - Mouse: ENSMUSG00000068587
• Gene ID - Rat: ENSRNOG00000026177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MGAM pAb (ATL-HPA002270 w/enhanced validation) – 1 Found

Park, Jihye; Jeong, Daeun; Chung, Youn Wook; Han, Seunghan; Kim, Da Hye; Yu, Jongwook; Cheon, Jae Hee; Ryu, Ji-Hwan. Proteomic analysis-based discovery of a novel biomarker that differentiates intestinal Behçet's disease from Crohn's disease. Scientific Reports. 2021;11(1):11019.