Anti MFSD4B pAb (ATL-HPA031784)

Atlas Antibodies

Catalog No.:
ATL-HPA031784-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: major facilitator superfamily domain containing 4B
Gene Name: MFSD4B
Alternative Gene Name: KIAA1919, MGC33953
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096687: 36%, ENSRNOG00000024543: 43%
Entrez Gene ID: 91749
Uniprot ID: Q5TF39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGLNEYEEENEEEDAEKWNEMDFEMIETNDTMRHSIIETSRSSLTEPTAEVYNQYPSNALVFESSPFNTGSAHVKHLPETR
Gene Sequence SGLNEYEEENEEEDAEKWNEMDFEMIETNDTMRHSIIETSRSSLTEPTAEVYNQYPSNALVFESSPFNTGSAHVKHLPETR
Gene ID - Mouse ENSMUSG00000096687
Gene ID - Rat ENSRNOG00000024543
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFSD4B pAb (ATL-HPA031784)
Datasheet Anti MFSD4B pAb (ATL-HPA031784) Datasheet (External Link)
Vendor Page Anti MFSD4B pAb (ATL-HPA031784) at Atlas Antibodies

Documents & Links for Anti MFSD4B pAb (ATL-HPA031784)
Datasheet Anti MFSD4B pAb (ATL-HPA031784) Datasheet (External Link)
Vendor Page Anti MFSD4B pAb (ATL-HPA031784)