Anti MFSD13A pAb (ATL-HPA018031)

Atlas Antibodies

Catalog No.: ATL-HPA018031-100

Protein Description: major facilitator superfamily domain containing 13A
Gene Name: MFSD13A
Alternative Gene Name: bA18I14.8, C10orf77, FLJ22529, TMEM180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025227: 65%, ENSRNOG00000019674: 72%
Entrez Gene ID: 79847
Uniprot ID: Q14CX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLLRRRVEAARKDPGCSGLVVDSGLCGEELLVGSEEADSITLGRYLRQLARHRN
• Gene Sequence: QLLRRRVEAARKDPGCSGLVVDSGLCGEELLVGSEEADSITLGRYLRQLARHRN
• Gene ID - Mouse: ENSMUSG00000025227
• Gene ID - Rat: ENSRNOG00000019674
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.