Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035166-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: METTL6
Alternative Gene Name: MGC24132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021891: 90%, ENSRNOG00000057372: 86%
Entrez Gene ID: 131965
Uniprot ID: Q8TCB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQ |
| Gene Sequence | MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQ |
| Gene ID - Mouse | ENSMUSG00000021891 |
| Gene ID - Rat | ENSRNOG00000057372 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) | |
| Datasheet | Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) | |
| Datasheet | Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) |
| Citations for Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) – 2 Found |
| Bolatkan, Amina; Asada, Ken; Kaneko, Syuzo; Suvarna, Kruthi; Ikawa, Noriko; Machino, Hidenori; Komatsu, Masaaki; Shiina, Shuichiro; Hamamoto, Ryuji. Downregulation of METTL6 mitigates cell progression, migration, invasion and adhesion in hepatocellular carcinoma by inhibiting cell adhesion molecules. International Journal Of Oncology. 2022;60(1) PubMed |
| Ignatova, Valentina V; Kaiser, Steffen; Ho, Jessica Sook Yuin; Bing, Xinyang; Stolz, Paul; Tan, Ying Xim; Lee, Chee Leng; Gay, Florence Pik Hoon; Lastres, Palma Rico; Gerlini, Raffaele; Rathkolb, Birgit; Aguilar-Pimentel, Antonio; Sanz-Moreno, Adrián; Klein-Rodewald, Tanja; Calzada-Wack, Julia; Ibragimov, Emil; Valenta, Magdalena; Lukauskas, Saulius; Pavesi, Andrea; Marschall, Susan; Leuchtenberger, Stefanie; Fuchs, Helmut; Gailus-Durner, Valerie; de Angelis, Martin Hrabe; Bultmann, Sebastian; Rando, Oliver J; Guccione, Ernesto; Kellner, Stefanie M; Schneider, Robert. METTL6 is a tRNA m(3)C methyltransferase that regulates pluripotency and tumor cell growth. Science Advances. 2020;6(35):eaaz4551. PubMed |