Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035166-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 6
Gene Name: METTL6
Alternative Gene Name: MGC24132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021891: 90%, ENSRNOG00000057372: 86%
Entrez Gene ID: 131965
Uniprot ID: Q8TCB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQ
Gene Sequence MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQ
Gene ID - Mouse ENSMUSG00000021891
Gene ID - Rat ENSRNOG00000057372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation)
Datasheet Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation)
Datasheet Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation)
Citations for Anti METTL6 pAb (ATL-HPA035166 w/enhanced validation) – 2 Found
Bolatkan, Amina; Asada, Ken; Kaneko, Syuzo; Suvarna, Kruthi; Ikawa, Noriko; Machino, Hidenori; Komatsu, Masaaki; Shiina, Shuichiro; Hamamoto, Ryuji. Downregulation of METTL6 mitigates cell progression, migration, invasion and adhesion in hepatocellular carcinoma by inhibiting cell adhesion molecules. International Journal Of Oncology. 2022;60(1)  PubMed
Ignatova, Valentina V; Kaiser, Steffen; Ho, Jessica Sook Yuin; Bing, Xinyang; Stolz, Paul; Tan, Ying Xim; Lee, Chee Leng; Gay, Florence Pik Hoon; Lastres, Palma Rico; Gerlini, Raffaele; Rathkolb, Birgit; Aguilar-Pimentel, Antonio; Sanz-Moreno, Adrián; Klein-Rodewald, Tanja; Calzada-Wack, Julia; Ibragimov, Emil; Valenta, Magdalena; Lukauskas, Saulius; Pavesi, Andrea; Marschall, Susan; Leuchtenberger, Stefanie; Fuchs, Helmut; Gailus-Durner, Valerie; de Angelis, Martin Hrabe; Bultmann, Sebastian; Rando, Oliver J; Guccione, Ernesto; Kellner, Stefanie M; Schneider, Robert. METTL6 is a tRNA m(3)C methyltransferase that regulates pluripotency and tumor cell growth. Science Advances. 2020;6(35):eaaz4551.  PubMed