Anti METTL5 pAb (ATL-HPA038223)

Atlas Antibodies

Catalog No.: ATL-HPA038223-25

Protein Description: methyltransferase like 5
Gene Name: METTL5
Alternative Gene Name: HSPC133
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051730: 86%, ENSRNOG00000008469: 84%
Entrez Gene ID: 29081
Uniprot ID: Q9NRN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DIDEDALEIFNRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGT
• Gene Sequence: DIDEDALEIFNRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGT
• Gene ID - Mouse: ENSMUSG00000051730
• Gene ID - Rat: ENSRNOG00000008469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti METTL5 pAb (ATL-HPA038223) – 1 Found

Brūmele, Baiba; Mutso, Margit; Telanne, Lilian; Õunap, Kadri; Spunde, Karīna; Abroi, Aare; Kurg, Reet. Human TRMT112-Methyltransferase Network Consists of Seven Partners Interacting with a Common Co-Factor. International Journal Of Molecular Sciences. 2021;22(24)