Anti METTL4 pAb (ATL-HPA040061)

Atlas Antibodies

Catalog No.: ATL-HPA040061-25

Protein Description: methyltransferase like 4
Gene Name: METTL4
Alternative Gene Name: FLJ23017, HsT661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055660: 54%, ENSRNOG00000026280: 55%
Entrez Gene ID: 64863
Uniprot ID: Q8N3J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGV
• Gene Sequence: NYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGV
• Gene ID - Mouse: ENSMUSG00000055660
• Gene ID - Rat: ENSRNOG00000026280
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti METTL4 pAb (ATL-HPA040061) – 3 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. 

Hao, Ziyang; Wu, Tong; Cui, Xiaolong; Zhu, Pingping; Tan, Caiping; Dou, Xiaoyang; Hsu, Kai-Wen; Lin, Yueh-Te; Peng, Pei-Hua; Zhang, Li-Sheng; Gao, Yawei; Hu, Lulu; Sun, Hui-Lung; Zhu, Allen; Liu, Jianzhao; Wu, Kou-Juey; He, Chuan. N(6)-Deoxyadenosine Methylation in Mammalian Mitochondrial DNA. Molecular Cell. 2020;78(3):382-395.e8. 

Condic, Mateja; Thiesler, Thore; Staerk, Christian; Klümper, Niklas; Ellinger, Jörg; Egger, Eva K; Kübler, Kirsten; Kristiansen, Glen; Mustea, Alexander; Ralser, Damian J. N6-methyladenosine RNA modification (m6A) is of prognostic value in HPV-dependent vulvar squamous cell carcinoma. Bmc Cancer. 2022;22(1):943.