Anti METTL24 pAb (ATL-HPA037441)

Atlas Antibodies

Catalog No.:
ATL-HPA037441-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 24
Gene Name: METTL24
Alternative Gene Name: C6orf186, dJ71D21.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045555: 85%, ENSRNOG00000024221: 80%
Entrez Gene ID: 728464
Uniprot ID: Q5JXM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQSLDEEAWRFLRYISTTQIACNHMNTDSLATDSSPTHKPWSVCLDDRFNLAHQIRNKQCRLYSLGLGSDDTHFEVSMANNGCEV
Gene Sequence AQSLDEEAWRFLRYISTTQIACNHMNTDSLATDSSPTHKPWSVCLDDRFNLAHQIRNKQCRLYSLGLGSDDTHFEVSMANNGCEV
Gene ID - Mouse ENSMUSG00000045555
Gene ID - Rat ENSRNOG00000024221
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL24 pAb (ATL-HPA037441)
Datasheet Anti METTL24 pAb (ATL-HPA037441) Datasheet (External Link)
Vendor Page Anti METTL24 pAb (ATL-HPA037441) at Atlas Antibodies

Documents & Links for Anti METTL24 pAb (ATL-HPA037441)
Datasheet Anti METTL24 pAb (ATL-HPA037441) Datasheet (External Link)
Vendor Page Anti METTL24 pAb (ATL-HPA037441)