Anti METTL21B pAb (ATL-HPA043020)

Atlas Antibodies

Catalog No.: ATL-HPA043020-25

Protein Description: methyltransferase like 21B
Gene Name: METTL21B
Alternative Gene Name: DKFZP586D0919, FAM119B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000080115: 84%, ENSRNOG00000047631: 83%
Entrez Gene ID: 25895
Uniprot ID: Q96AZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA
• Gene Sequence: TFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA
• Gene ID - Mouse: ENSMUSG00000080115
• Gene ID - Rat: ENSRNOG00000047631
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti METTL21B pAb (ATL-HPA043020) – 1 Found

Shu, Xin; Li, Xinquan; Xiang, Xiaochen; Wang, Qiang; Wu, Qingming. METTL21B is a prognostic biomarker and potential therapeutic target in low-grade gliomas. Aging. 2021;13(16):20661-20683.