Anti METTL13 pAb (ATL-HPA044498)

Atlas Antibodies

Catalog No.:
ATL-HPA044498-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 13
Gene Name: METTL13
Alternative Gene Name: CGI-01, KIAA0859
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026694: 90%, ENSRNOG00000007864: 26%
Entrez Gene ID: 51603
Uniprot ID: Q8N6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
Gene Sequence FVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
Gene ID - Mouse ENSMUSG00000026694
Gene ID - Rat ENSRNOG00000007864
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL13 pAb (ATL-HPA044498)
Datasheet Anti METTL13 pAb (ATL-HPA044498) Datasheet (External Link)
Vendor Page Anti METTL13 pAb (ATL-HPA044498) at Atlas Antibodies

Documents & Links for Anti METTL13 pAb (ATL-HPA044498)
Datasheet Anti METTL13 pAb (ATL-HPA044498) Datasheet (External Link)
Vendor Page Anti METTL13 pAb (ATL-HPA044498)