Anti METTL13 pAb (ATL-HPA044498)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044498-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: METTL13
Alternative Gene Name: CGI-01, KIAA0859
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026694: 90%, ENSRNOG00000007864: 26%
Entrez Gene ID: 51603
Uniprot ID: Q8N6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV |
| Gene Sequence | FVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV |
| Gene ID - Mouse | ENSMUSG00000026694 |
| Gene ID - Rat | ENSRNOG00000007864 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL13 pAb (ATL-HPA044498) | |
| Datasheet | Anti METTL13 pAb (ATL-HPA044498) Datasheet (External Link) |
| Vendor Page | Anti METTL13 pAb (ATL-HPA044498) at Atlas Antibodies |
| Documents & Links for Anti METTL13 pAb (ATL-HPA044498) | |
| Datasheet | Anti METTL13 pAb (ATL-HPA044498) Datasheet (External Link) |
| Vendor Page | Anti METTL13 pAb (ATL-HPA044498) |