Anti METTL11B pAb (ATL-HPA028049)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028049-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: METTL11B
Alternative Gene Name: C1orf184, HOMT1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040113: 94%, ENSRNOG00000025415: 94%
Entrez Gene ID: 149281
Uniprot ID: Q5VVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL |
| Gene Sequence | GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL |
| Gene ID - Mouse | ENSMUSG00000040113 |
| Gene ID - Rat | ENSRNOG00000025415 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL11B pAb (ATL-HPA028049) | |
| Datasheet | Anti METTL11B pAb (ATL-HPA028049) Datasheet (External Link) |
| Vendor Page | Anti METTL11B pAb (ATL-HPA028049) at Atlas Antibodies |
| Documents & Links for Anti METTL11B pAb (ATL-HPA028049) | |
| Datasheet | Anti METTL11B pAb (ATL-HPA028049) Datasheet (External Link) |
| Vendor Page | Anti METTL11B pAb (ATL-HPA028049) |