Anti METTL11B pAb (ATL-HPA028049)

Atlas Antibodies

Catalog No.:
ATL-HPA028049-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 11B
Gene Name: METTL11B
Alternative Gene Name: C1orf184, HOMT1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040113: 94%, ENSRNOG00000025415: 94%
Entrez Gene ID: 149281
Uniprot ID: Q5VVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL
Gene Sequence GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL
Gene ID - Mouse ENSMUSG00000040113
Gene ID - Rat ENSRNOG00000025415
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL11B pAb (ATL-HPA028049)
Datasheet Anti METTL11B pAb (ATL-HPA028049) Datasheet (External Link)
Vendor Page Anti METTL11B pAb (ATL-HPA028049) at Atlas Antibodies

Documents & Links for Anti METTL11B pAb (ATL-HPA028049)
Datasheet Anti METTL11B pAb (ATL-HPA028049) Datasheet (External Link)
Vendor Page Anti METTL11B pAb (ATL-HPA028049)