Anti MEGF9 pAb (ATL-HPA014319)

Atlas Antibodies

Catalog No.:
ATL-HPA014319-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: multiple EGF-like-domains 9
Gene Name: MEGF9
Alternative Gene Name: EGFL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039270: 98%, ENSRNOG00000005932: 98%
Entrez Gene ID: 1955
Uniprot ID: Q9H1U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
Gene Sequence YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
Gene ID - Mouse ENSMUSG00000039270
Gene ID - Rat ENSRNOG00000005932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEGF9 pAb (ATL-HPA014319)
Datasheet Anti MEGF9 pAb (ATL-HPA014319) Datasheet (External Link)
Vendor Page Anti MEGF9 pAb (ATL-HPA014319) at Atlas Antibodies

Documents & Links for Anti MEGF9 pAb (ATL-HPA014319)
Datasheet Anti MEGF9 pAb (ATL-HPA014319) Datasheet (External Link)
Vendor Page Anti MEGF9 pAb (ATL-HPA014319)