Anti MED8 pAb (ATL-HPA028377)

Atlas Antibodies

Catalog No.: ATL-HPA028377-25

Protein Description: mediator complex subunit 8
Gene Name: MED8
Alternative Gene Name: ARC32, MGC17544, MGC19641
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006392: 100%, ENSRNOG00000019211: 32%
Entrez Gene ID: 112950
Uniprot ID: Q96G25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQ
• Gene Sequence: VIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQ
• Gene ID - Mouse: ENSMUSG00000006392
• Gene ID - Rat: ENSRNOG00000019211
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MED8 pAb (ATL-HPA028377) – 1 Found

Syring, Isabella; Klümper, Niklas; Offermann, Anne; Braun, Martin; Deng, Mario; Boehm, Diana; Queisser, Angela; von Mässenhausen, Anne; Brägelmann, Johannes; Vogel, Wenzel; Schmidt, Doris; Majores, Michael; Schindler, Anne; Kristiansen, Glen; Müller, Stefan C; Ellinger, Jörg; Adler, David; Perner, Sven. Comprehensive analysis of the transcriptional profile of the Mediator complex across human cancer types. Oncotarget. 2016;7(17):23043-23055.