Anti ME3 pAb (ATL-HPA038473 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038473-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ME3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030621: 87%, ENSRNOG00000017311: 76%
Entrez Gene ID: 10873
Uniprot ID: Q16798
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV |
| Gene Sequence | DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV |
| Gene ID - Mouse | ENSMUSG00000030621 |
| Gene ID - Rat | ENSRNOG00000017311 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ME3 pAb (ATL-HPA038473 w/enhanced validation) | |
| Datasheet | Anti ME3 pAb (ATL-HPA038473 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ME3 pAb (ATL-HPA038473 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ME3 pAb (ATL-HPA038473 w/enhanced validation) | |
| Datasheet | Anti ME3 pAb (ATL-HPA038473 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ME3 pAb (ATL-HPA038473 w/enhanced validation) |
| Citations for Anti ME3 pAb (ATL-HPA038473 w/enhanced validation) – 1 Found |
| Dey, Prasenjit; Baddour, Joelle; Muller, Florian; Wu, Chia Chin; Wang, Huamin; Liao, Wen-Ting; Lan, Zangdao; Chen, Alina; Gutschner, Tony; Kang, Yaan; Fleming, Jason; Satani, Nikunj; Zhao, Di; Achreja, Abhinav; Yang, Lifeng; Lee, Jiyoon; Chang, Edward; Genovese, Giannicola; Viale, Andrea; Ying, Haoqiang; Draetta, Giulio; Maitra, Anirban; Wang, Y Alan; Nagrath, Deepak; DePinho, Ronald A. Genomic deletion of malic enzyme 2 confers collateral lethality in pancreatic cancer. Nature. 2017;542(7639):119-123. PubMed |