Anti ME1 pAb (ATL-HPA006493 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA006493-100
Immunohistochemistry analysis in human adrenal gland and kidney tissues using Anti-ME1 antibody. Corresponding ME1 RNA-seq data are presented for the same tissues.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: malic enzyme 1, NADP(+)-dependent, cytosolic
Gene Name: ME1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032418: 92%, ENSRNOG00000009715: 93%
Entrez Gene ID: 4199
Uniprot ID: P48163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAEC
Gene Sequence RITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAEC
Gene ID - Mouse ENSMUSG00000032418
Gene ID - Rat ENSRNOG00000009715
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ME1 pAb (ATL-HPA006493 w/enhanced validation)
Datasheet Anti ME1 pAb (ATL-HPA006493 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ME1 pAb (ATL-HPA006493 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ME1 pAb (ATL-HPA006493 w/enhanced validation)
Datasheet Anti ME1 pAb (ATL-HPA006493 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ME1 pAb (ATL-HPA006493 w/enhanced validation)
Citations for Anti ME1 pAb (ATL-HPA006493 w/enhanced validation) – 1 Found
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
!