Anti MDH2 pAb (ATL-HPA026720 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026720-25

Protein Description: malate dehydrogenase 2, NAD (mitochondrial)
Gene Name: MDH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019179: 96%, ENSRNOG00000001440: 95%
Entrez Gene ID: 4191
Uniprot ID: P40926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPE
• Gene Sequence: MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPE
• Gene ID - Mouse: ENSMUSG00000019179
• Gene ID - Rat: ENSRNOG00000001440
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.