Anti MCMBP pAb (ATL-HPA038481)

Atlas Antibodies

Catalog No.: ATL-HPA038481-25

Protein Description: minichromosome maintenance complex binding protein
Gene Name: MCMBP
Alternative Gene Name: C10orf119, FLJ13081, MCM-BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048170: 88%, ENSRNOG00000020394: 90%
Entrez Gene ID: 79892
Uniprot ID: Q9BTE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQ
• Gene Sequence: SPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQ
• Gene ID - Mouse: ENSMUSG00000048170
• Gene ID - Rat: ENSRNOG00000020394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCMBP pAb (ATL-HPA038481) – 1 Found

Tamberg, Nele; Tahk, Siret; Koit, Sandra; Kristjuhan, Kersti; Kasvandik, Sergo; Kristjuhan, Arnold; Ilves, Ivar. Keap1-MCM3 interaction is a potential coordinator of molecular machineries of antioxidant response and genomic DNA replication in metazoa. Scientific Reports. 2018;8(1):12136.