Anti MCM3AP pAb (ATL-HPA032103)

Atlas Antibodies

Catalog No.: ATL-HPA032103-25

Protein Description: minichromosome maintenance complex component 3 associated protein
Gene Name: MCM3AP
Alternative Gene Name: GANP, KIAA0572, Map80, SAC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001150: 100%, ENSRNOG00000001272: 100%
Entrez Gene ID: 8888
Uniprot ID: O60318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE
• Gene Sequence: RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE
• Gene ID - Mouse: ENSMUSG00000001150
• Gene ID - Rat: ENSRNOG00000001272
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.