Anti MCM3AP pAb (ATL-HPA021527)

Atlas Antibodies

Catalog No.: ATL-HPA021527-25

Protein Description: minichromosome maintenance complex component 3 associated protein
Gene Name: MCM3AP
Alternative Gene Name: GANP, KIAA0572, Map80, SAC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001150: 75%, ENSRNOG00000001272: 82%
Entrez Gene ID: 8888
Uniprot ID: O60318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDYL
• Gene Sequence: HEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDYL
• Gene ID - Mouse: ENSMUSG00000001150
• Gene ID - Rat: ENSRNOG00000001272
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCM3AP pAb (ATL-HPA021527) – 2 Found

Singh, Shailendra Kumar; Maeda, Kazuhiko; Eid, Mohammed Mansour Abbas; Almofty, Sarah Ameen; Ono, Masaya; Pham, Phuong; Goodman, Myron F; Sakaguchi, Nobuo. GANP regulates recruitment of AID to immunoglobulin variable regions by modulating transcription and nucleosome occupancy. Nature Communications. 4( 23652018):1830. 

Meyers, Jordan M; Ramanathan, Muthukumar; Shanderson, Ronald L; Beck, Aimee; Donohue, Laura; Ferguson, Ian; Guo, Margaret G; Rao, Deepti S; Miao, Weili; Reynolds, David; Yang, Xue; Zhao, Yang; Yang, Yen-Yu; Blish, Catherine; Wang, Yinsheng; Khavari, Paul A. The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation. Plos Pathogens. 2021;17(10):e1009412.