Anti MCM2 pAb (ATL-HPA031496 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031496-25

Protein Description: minichromosome maintenance complex component 2
Gene Name: MCM2
Alternative Gene Name: BM28, CCNL1, cdc19, CDCL1, D3S3194, KIAA0030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002870: 91%, ENSRNOG00000016316: 91%
Entrez Gene ID: 4171
Uniprot ID: P49736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQD
• Gene Sequence: RFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQD
• Gene ID - Mouse: ENSMUSG00000002870
• Gene ID - Rat: ENSRNOG00000016316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCM2 pAb (ATL-HPA031496 w/enhanced validation) – 4 Found

Tang, Zengwei; Yang, Yuan; Chen, Wen; Li, Enliang; Liang, Tingbo. Demethylation at enhancer upregulates MCM2 and NUP37 expression predicting poor survival in hepatocellular carcinoma patients. Journal Of Translational Medicine. 2022;20(1):49. 

Samad, Abdus; Haque, Farhana; Nain, Zulkar; Alam, Rahat; Al Noman, Md Abdullah; Rahman Molla, Mohammad Habibur; Hossen, Md Saddam; Islam, Md Raquibul; Khan, Md Iqbal; Ahammad, Foysal. Computational assessment of MCM2 transcriptional expression and identification of the prognostic biomarker for human breast cancer. Heliyon. 2020;6(10):e05087. 

Yuan, Meng; Shong, Koeun; Li, Xiangyu; Ashraf, Sajda; Shi, Mengnan; Kim, Woonghee; Nielsen, Jens; Turkez, Hasan; Shoaie, Saeed; Uhlen, Mathias; Zhang, Cheng; Mardinoglu, Adil. A Gene Co-Expression Network-Based Drug Repositioning Approach Identifies Candidates for Treatment of Hepatocellular Carcinoma. Cancers. 2022;14(6) 

Yuan, Jing; Lan, Hua; Huang, Dongqing; Guo, Xiaohui; Liu, Chu; Liu, Shuping; Zhang, Peng; Cheng, Yan; Xiao, Songshu. Multi-Omics Analysis of MCM2 as a Promising Biomarker in Pan-Cancer. Frontiers In Cell And Developmental Biology. 10( 35693940):852135.