Anti MCCC1 pAb (ATL-HPA008310)

Atlas Antibodies

Catalog No.: ATL-HPA008310-25

Protein Description: methylcrotonoyl-CoA carboxylase 1 (alpha)
Gene Name: MCCC1
Alternative Gene Name: MCCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027709: 90%, ENSRNOG00000013293: 90%
Entrez Gene ID: 56922
Uniprot ID: Q96RQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETGVRQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIPQHH
• Gene Sequence: ITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETGVRQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIPQHH
• Gene ID - Mouse: ENSMUSG00000027709
• Gene ID - Rat: ENSRNOG00000013293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.