Anti MBNL1 pAb (ATL-HPA035098)

Atlas Antibodies

Catalog No.:
ATL-HPA035098-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: muscleblind-like splicing regulator 1
Gene Name: MBNL1
Alternative Gene Name: EXP, EXP35, EXP40, EXP42, KIAA0428, MBNL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027763: 97%, ENSRNOG00000014076: 99%
Entrez Gene ID: 4154
Uniprot ID: Q9NR56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA
Gene Sequence KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA
Gene ID - Mouse ENSMUSG00000027763
Gene ID - Rat ENSRNOG00000014076
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MBNL1 pAb (ATL-HPA035098)
Datasheet Anti MBNL1 pAb (ATL-HPA035098) Datasheet (External Link)
Vendor Page Anti MBNL1 pAb (ATL-HPA035098) at Atlas Antibodies

Documents & Links for Anti MBNL1 pAb (ATL-HPA035098)
Datasheet Anti MBNL1 pAb (ATL-HPA035098) Datasheet (External Link)
Vendor Page Anti MBNL1 pAb (ATL-HPA035098)