Anti MBD6 pAb (ATL-HPA038949)

Atlas Antibodies

Catalog No.: ATL-HPA038949-25

Protein Description: methyl-CpG binding domain protein 6
Gene Name: MBD6
Alternative Gene Name: KIAA1887
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025409: 91%, ENSRNOG00000006209: 89%
Entrez Gene ID: 114785
Uniprot ID: Q96DN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARAA
• Gene Sequence: MERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARAA
• Gene ID - Mouse: ENSMUSG00000025409
• Gene ID - Rat: ENSRNOG00000006209
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.