Anti MBD3L1 pAb (ATL-HPA043121)

Atlas Antibodies

Catalog No.: ATL-HPA043121-25

Protein Description: methyl-CpG binding domain protein 3-like 1
Gene Name: MBD3L1
Alternative Gene Name: MBD3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038691: 80%, ENSRNOG00000006363: 79%
Entrez Gene ID: 85509
Uniprot ID: Q8WWY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAG
• Gene Sequence: MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAG
• Gene ID - Mouse: ENSMUSG00000038691
• Gene ID - Rat: ENSRNOG00000006363
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.