Anti MB21D2 pAb (ATL-HPA044026)

Atlas Antibodies

Catalog No.:
ATL-HPA044026-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Mab-21 domain containing 2
Gene Name: MB21D2
Alternative Gene Name: C3orf59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051065: 98%, ENSRNOG00000024040: 99%
Entrez Gene ID: 151963
Uniprot ID: Q8IYB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFDEGTISKWKDCCTIVDHINGATNYFFSPTKVADWFYDSISIVLSEIQKKPQRGMPKVEKVEKNGTIISIILGVGSSRMLYDIVPVVSFKGW
Gene Sequence LFDEGTISKWKDCCTIVDHINGATNYFFSPTKVADWFYDSISIVLSEIQKKPQRGMPKVEKVEKNGTIISIILGVGSSRMLYDIVPVVSFKGW
Gene ID - Mouse ENSMUSG00000051065
Gene ID - Rat ENSRNOG00000024040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MB21D2 pAb (ATL-HPA044026)
Datasheet Anti MB21D2 pAb (ATL-HPA044026) Datasheet (External Link)
Vendor Page Anti MB21D2 pAb (ATL-HPA044026) at Atlas Antibodies

Documents & Links for Anti MB21D2 pAb (ATL-HPA044026)
Datasheet Anti MB21D2 pAb (ATL-HPA044026) Datasheet (External Link)
Vendor Page Anti MB21D2 pAb (ATL-HPA044026)