Anti MATN1 pAb (ATL-HPA028580)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028580-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MATN1
Alternative Gene Name: CMP, CRTM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040533: 87%, ENSRNOG00000010932: 88%
Entrez Gene ID: 4146
Uniprot ID: P21941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV |
| Gene Sequence | REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV |
| Gene ID - Mouse | ENSMUSG00000040533 |
| Gene ID - Rat | ENSRNOG00000010932 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MATN1 pAb (ATL-HPA028580) | |
| Datasheet | Anti MATN1 pAb (ATL-HPA028580) Datasheet (External Link) |
| Vendor Page | Anti MATN1 pAb (ATL-HPA028580) at Atlas Antibodies |
| Documents & Links for Anti MATN1 pAb (ATL-HPA028580) | |
| Datasheet | Anti MATN1 pAb (ATL-HPA028580) Datasheet (External Link) |
| Vendor Page | Anti MATN1 pAb (ATL-HPA028580) |
| Citations for Anti MATN1 pAb (ATL-HPA028580) – 1 Found |
| Bell, Peter A; Piróg, Katarzyna A; Fresquet, Maryline; Thornton, David J; Boot-Handford, Raymond P; Briggs, Michael D. Loss of matrilin 1 does not exacerbate the skeletal phenotype in a mouse model of multiple epiphyseal dysplasia caused by a Matn3 V194D mutation. Arthritis And Rheumatism. 2012;64(5):1529-39. PubMed |