Anti MATN1 pAb (ATL-HPA028580)

Atlas Antibodies

Catalog No.:
ATL-HPA028580-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: matrilin 1, cartilage matrix protein
Gene Name: MATN1
Alternative Gene Name: CMP, CRTM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040533: 87%, ENSRNOG00000010932: 88%
Entrez Gene ID: 4146
Uniprot ID: P21941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
Gene Sequence REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
Gene ID - Mouse ENSMUSG00000040533
Gene ID - Rat ENSRNOG00000010932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MATN1 pAb (ATL-HPA028580)
Datasheet Anti MATN1 pAb (ATL-HPA028580) Datasheet (External Link)
Vendor Page Anti MATN1 pAb (ATL-HPA028580) at Atlas Antibodies

Documents & Links for Anti MATN1 pAb (ATL-HPA028580)
Datasheet Anti MATN1 pAb (ATL-HPA028580) Datasheet (External Link)
Vendor Page Anti MATN1 pAb (ATL-HPA028580)
Citations for Anti MATN1 pAb (ATL-HPA028580) – 1 Found
Bell, Peter A; Piróg, Katarzyna A; Fresquet, Maryline; Thornton, David J; Boot-Handford, Raymond P; Briggs, Michael D. Loss of matrilin 1 does not exacerbate the skeletal phenotype in a mouse model of multiple epiphyseal dysplasia caused by a Matn3 V194D mutation. Arthritis And Rheumatism. 2012;64(5):1529-39.  PubMed