Anti MAST3 pAb (ATL-HPA035061)

Atlas Antibodies

Catalog No.: ATL-HPA035061-25

Protein Description: microtubule associated serine/threonine kinase 3
Gene Name: MAST3
Alternative Gene Name: KIAA0561
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110763: 85%, ENSRNOG00000022753: 83%
Entrez Gene ID: 23031
Uniprot ID: O60307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVFILGEPDPPPAATPVMPKPSSLSADTAALSHARLRSNSIGARHSTPRPLDASRGRRLGGPRDPAPEKSR
• Gene Sequence: PVFILGEPDPPPAATPVMPKPSSLSADTAALSHARLRSNSIGARHSTPRPLDASRGRRLGGPRDPAPEKSR
• Gene ID - Mouse: ENSMUSG00000110763
• Gene ID - Rat: ENSRNOG00000022753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.