Anti MARS2 pAb (ATL-HPA035590)

Atlas Antibodies

Catalog No.:
ATL-HPA035590-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: methionyl-tRNA synthetase 2, mitochondrial
Gene Name: MARS2
Alternative Gene Name: mtMetRS, SPAX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046994: 84%, ENSRNOG00000050002: 84%
Entrez Gene ID: 92935
Uniprot ID: Q96GW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLNSELADALGGLLNRCTAKRINPSETYPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNG
Gene Sequence LLNSELADALGGLLNRCTAKRINPSETYPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNG
Gene ID - Mouse ENSMUSG00000046994
Gene ID - Rat ENSRNOG00000050002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MARS2 pAb (ATL-HPA035590)
Datasheet Anti MARS2 pAb (ATL-HPA035590) Datasheet (External Link)
Vendor Page Anti MARS2 pAb (ATL-HPA035590) at Atlas Antibodies

Documents & Links for Anti MARS2 pAb (ATL-HPA035590)
Datasheet Anti MARS2 pAb (ATL-HPA035590) Datasheet (External Link)
Vendor Page Anti MARS2 pAb (ATL-HPA035590)