Anti MARS2 pAb (ATL-HPA035589)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035589-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MARS2
Alternative Gene Name: mtMetRS, SPAX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046994: 92%, ENSRNOG00000050002: 93%
Entrez Gene ID: 92935
Uniprot ID: Q96GW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT |
| Gene Sequence | WLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT |
| Gene ID - Mouse | ENSMUSG00000046994 |
| Gene ID - Rat | ENSRNOG00000050002 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MARS2 pAb (ATL-HPA035589) | |
| Datasheet | Anti MARS2 pAb (ATL-HPA035589) Datasheet (External Link) |
| Vendor Page | Anti MARS2 pAb (ATL-HPA035589) at Atlas Antibodies |
| Documents & Links for Anti MARS2 pAb (ATL-HPA035589) | |
| Datasheet | Anti MARS2 pAb (ATL-HPA035589) Datasheet (External Link) |
| Vendor Page | Anti MARS2 pAb (ATL-HPA035589) |
| Citations for Anti MARS2 pAb (ATL-HPA035589) – 1 Found |
| Webb, Bryn D; Wheeler, Patricia G; Hagen, Jacob J; Cohen, Ninette; Linderman, Michael D; Diaz, George A; Naidich, Thomas P; Rodenburg, Richard J; Houten, Sander M; Schadt, Eric E. Novel, compound heterozygous, single-nucleotide variants in MARS2 associated with developmental delay, poor growth, and sensorineural hearing loss. Human Mutation. 2015;36(6):587-92. PubMed |