Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014275-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: membrane-associated ring finger (C3HC4) 7, E3 ubiquitin protein ligase
Gene Name: MARCH7
Alternative Gene Name: AXOT, MARCH-VII, RNF177
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026977: 92%, ENSRNOG00000006241: 92%
Entrez Gene ID: 64844
Uniprot ID: Q9H992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK
Gene Sequence ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK
Gene ID - Mouse ENSMUSG00000026977
Gene ID - Rat ENSRNOG00000006241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation)
Datasheet Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation)
Datasheet Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation)
Citations for Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation) – 1 Found
Szigyarto, Cristina A; Sibbons, Paul; Williams, Gill; Uhlen, Mathias; Metcalfe, Su M. The E3 ligase axotrophin/MARCH-7: protein expression profiling of human tissues reveals links to adult stem cells. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2010;58(4):301-8.  PubMed