Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014275-25

Protein Description: membrane-associated ring finger (C3HC4) 7, E3 ubiquitin protein ligase
Gene Name: MARCH7
Alternative Gene Name: AXOT, MARCH-VII, RNF177
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026977: 92%, ENSRNOG00000006241: 92%
Entrez Gene ID: 64844
Uniprot ID: Q9H992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK
• Gene Sequence: ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK
• Gene ID - Mouse: ENSMUSG00000026977
• Gene ID - Rat: ENSRNOG00000006241
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MARCH7 pAb (ATL-HPA014275 w/enhanced validation) – 1 Found

Szigyarto, Cristina A; Sibbons, Paul; Williams, Gill; Uhlen, Mathias; Metcalfe, Su M. The E3 ligase axotrophin/MARCH-7: protein expression profiling of human tissues reveals links to adult stem cells. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2010;58(4):301-8.