Anti MARCH3 pAb (ATL-HPA043406 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043406-25

Protein Description: membrane-associated ring finger (C3HC4) 3, E3 ubiquitin protein ligase
Gene Name: MARCH3
Alternative Gene Name: MARCH-III, MGC48332, RNF173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032656: 96%, ENSRNOG00000023013: 94%
Entrez Gene ID: 115123
Uniprot ID: Q86UD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV
• Gene Sequence: FRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV
• Gene ID - Mouse: ENSMUSG00000032656
• Gene ID - Rat: ENSRNOG00000023013
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.