Anti MAP7D3 pAb (ATL-HPA035598)

Atlas Antibodies

Catalog No.: ATL-HPA035598-25

Protein Description: MAP7 domain containing 3
Gene Name: MAP7D3
Alternative Gene Name: FLJ12649
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067878: 40%, ENSRNOG00000027831: 38%
Entrez Gene ID: 79649
Uniprot ID: Q8IWC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EADNEESDKDSLNEMFPSAILNGTGSPTKFKMPFNNAKKMTHKLVFLEDGTSQVRKEPKTYFNGDLKNFRQKSMKDTSIQEVVSRPSSKRMTSH
• Gene Sequence: EADNEESDKDSLNEMFPSAILNGTGSPTKFKMPFNNAKKMTHKLVFLEDGTSQVRKEPKTYFNGDLKNFRQKSMKDTSIQEVVSRPSSKRMTSH
• Gene ID - Mouse: ENSMUSG00000067878
• Gene ID - Rat: ENSRNOG00000027831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAP7D3 pAb (ATL-HPA035598) – 4 Found

Hooikaas, Peter Jan; Martin, Maud; Mühlethaler, Tobias; Kuijntjes, Gert-Jan; Peeters, Cathelijn A E; Katrukha, Eugene A; Ferrari, Luca; Stucchi, Riccardo; Verhagen, Daan G F; van Riel, Wilhelmina E; Grigoriev, Ilya; Altelaar, A F Maarten; Hoogenraad, Casper C; Rüdiger, Stefan G D; Steinmetz, Michel O; Kapitein, Lukas C; Akhmanova, Anna. MAP7 family proteins regulate kinesin-1 recruitment and activation. The Journal Of Cell Biology. 2019;218(4):1298-1318. 

Pan, Xingxiu; Cao, Yujie; Stucchi, Riccardo; Hooikaas, Peter Jan; Portegies, Sybren; Will, Lena; Martin, Maud; Akhmanova, Anna; Harterink, Martin; Hoogenraad, Casper C. MAP7D2 Localizes to the Proximal Axon and Locally Promotes Kinesin-1-Mediated Cargo Transport into the Axon. Cell Reports. 2019;26(8):1988-1999.e6. 

Arabi, Azadeh; Ullah, Karim; Branca, Rui M M; Johansson, Johan; Bandarra, Daniel; Haneklaus, Moritz; Fu, Jing; Ariës, Ingrid; Nilsson, Peter; Den Boer, Monique L; Pokrovskaja, Katja; Grandér, Dan; Xiao, Gutian; Rocha, Sonia; Lehtiö, Janne; Sangfelt, Olle. Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway. Nature Communications. 3( 22864569):976. 

Serra-Marques, Andrea; Martin, Maud; Katrukha, Eugene A; Grigoriev, Ilya; Peeters, Cathelijn Ae; Liu, Qingyang; Hooikaas, Peter Jan; Yao, Yao; Solianova, Veronika; Smal, Ihor; Pedersen, Lotte B; Meijering, Erik; Kapitein, Lukas C; Akhmanova, Anna. Concerted action of kinesins KIF5B and KIF13B promotes efficient secretory vesicle transport to microtubule plus ends. Elife. 2020;9( 33174839)