Anti MAP4K4 pAb (ATL-HPA008476 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008476-25

Protein Description: mitogen-activated protein kinase kinase kinase kinase 4
Gene Name: MAP4K4
Alternative Gene Name: FLH21957, HGK, NIK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026074: 97%, ENSRNOG00000014013: 97%
Entrez Gene ID: 9448
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSSI
• Gene Sequence: AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSSI
• Gene ID - Mouse: ENSMUSG00000026074
• Gene ID - Rat: ENSRNOG00000014013
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAP4K4 pAb (ATL-HPA008476 w/enhanced validation) – 1 Found

Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244.