Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038150-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MAP4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032479: 48%, ENSRNOG00000020748: 47%
Entrez Gene ID: 4134
Uniprot ID: P27816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVV |
| Gene Sequence | PPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVV |
| Gene ID - Mouse | ENSMUSG00000032479 |
| Gene ID - Rat | ENSRNOG00000020748 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation) | |
| Datasheet | Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation) | |
| Datasheet | Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation) |
| Citations for Anti MAP4 pAb (ATL-HPA038150 w/enhanced validation) – 1 Found |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |