Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038149-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/89899/163879/atl-hpa038149_anti-map4-pab-atl-hpa038149-wenhanced-validation_45519__56898.1681116171.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MAP4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032479: 41%, ENSRNOG00000020748: 45%
Entrez Gene ID: 4134
Uniprot ID: P27816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT |
| Gene Sequence | EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT |
| Gene ID - Mouse | ENSMUSG00000032479 |
| Gene ID - Rat | ENSRNOG00000020748 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation) | |
| Datasheet | Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation) | |
| Datasheet | Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation) |
| Citations for Anti MAP4 pAb (ATL-HPA038149 w/enhanced validation) – 2 Found |
| Jiang, Pengtao; Li, Yueran; Poleshko, Andrey; Medvedeva, Valentina; Baulina, Natalia; Zhang, Yongchao; Zhou, Yan; Slater, Carolyn M; Pellegrin, Trinity; Wasserman, Jason; Lindy, Michael; Efimov, Andrey; Daly, Mary; Katz, Richard A; Chen, Xiaowei. The Protein Encoded by the CCDC170 Breast Cancer Gene Functions to Organize the Golgi-Microtubule Network. Ebiomedicine. 2017;22( 28687497):28-43. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |