Anti MAP2K1 pAb (ATL-HPA026430)

Atlas Antibodies

Catalog No.:
ATL-HPA026430-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: mitogen-activated protein kinase kinase 1
Gene Name: MAP2K1
Alternative Gene Name: MAPKK1, MEK1, PRKMK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004936: 100%, ENSRNOG00000010176: 53%
Entrez Gene ID: 5604
Uniprot ID: Q02750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ
Gene Sequence MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ
Gene ID - Mouse ENSMUSG00000004936
Gene ID - Rat ENSRNOG00000010176
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP2K1 pAb (ATL-HPA026430)
Datasheet Anti MAP2K1 pAb (ATL-HPA026430) Datasheet (External Link)
Vendor Page Anti MAP2K1 pAb (ATL-HPA026430) at Atlas Antibodies

Documents & Links for Anti MAP2K1 pAb (ATL-HPA026430)
Datasheet Anti MAP2K1 pAb (ATL-HPA026430) Datasheet (External Link)
Vendor Page Anti MAP2K1 pAb (ATL-HPA026430)
Citations for Anti MAP2K1 pAb (ATL-HPA026430) – 2 Found
Bielecka, Zofia F; Malinowska, Agata; Brodaczewska, Klaudia K; Klemba, Aleksandra; Kieda, Claudine; Krasowski, Paweł; Grzesiuk, Elżbieta; Piwowarski, Jan; Czarnecka, Anna M; Szczylik, Cezary. Hypoxic 3D in vitro culture models reveal distinct resistance processes to TKIs in renal cancer cells. Cell & Bioscience. 7( 29270287):71.  PubMed
Pénzváltó, Zsófia; Lánczky, András; Lénárt, Julianna; Meggyesházi, Nóra; Krenács, Tibor; Szoboszlai, Norbert; Denkert, Carsten; Pete, Imre; Győrffy, Balázs. MEK1 is associated with carboplatin resistance and is a prognostic biomarker in epithelial ovarian cancer. Bmc Cancer. 2014;14( 25408231):837.  PubMed