Anti MANSC4 pAb (ATL-HPA039682)

Atlas Antibodies

Catalog No.:
ATL-HPA039682-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MANSC domain containing 4
Gene Name: MANSC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072662: 54%, ENSRNOG00000036925: 46%
Entrez Gene ID: 100287284
Uniprot ID: A6NHS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NESITTKINKVSPSTDFISNPDNKTISPFFEPIDTKLSHMPVPPGLNSSKQLLNKTKGYNSRNHTSANEDEVSVTSKT
Gene Sequence NESITTKINKVSPSTDFISNPDNKTISPFFEPIDTKLSHMPVPPGLNSSKQLLNKTKGYNSRNHTSANEDEVSVTSKT
Gene ID - Mouse ENSMUSG00000072662
Gene ID - Rat ENSRNOG00000036925
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MANSC4 pAb (ATL-HPA039682)
Datasheet Anti MANSC4 pAb (ATL-HPA039682) Datasheet (External Link)
Vendor Page Anti MANSC4 pAb (ATL-HPA039682) at Atlas Antibodies

Documents & Links for Anti MANSC4 pAb (ATL-HPA039682)
Datasheet Anti MANSC4 pAb (ATL-HPA039682) Datasheet (External Link)
Vendor Page Anti MANSC4 pAb (ATL-HPA039682)