Anti MAN2C1 pAb (ATL-HPA040627)

Atlas Antibodies

Catalog No.: ATL-HPA040627-25

Protein Description: mannosidase, alpha, class 2C, member 1
Gene Name: MAN2C1
Alternative Gene Name: MANA, MANA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032295: 87%, ENSRNOG00000030654: 86%
Entrez Gene ID: 4123
Uniprot ID: Q9NTJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLSSFLTPERLPYQEAVQRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLTKEGEKTSYVLTDRLGERDPRSLTLYVEVA
• Gene Sequence: VLSSFLTPERLPYQEAVQRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLTKEGEKTSYVLTDRLGERDPRSLTLYVEVA
• Gene ID - Mouse: ENSMUSG00000032295
• Gene ID - Rat: ENSRNOG00000030654
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAN2C1 pAb (ATL-HPA040627) – 1 Found

Barretta, Maria Luisa; Spano, Daniela; D'Ambrosio, Chiara; Cervigni, Romina Ines; Scaloni, Andrea; Corda, Daniela; Colanzi, Antonino. Aurora-A recruitment and centrosomal maturation are regulated by a Golgi-activated pool of Src during G2. Nature Communications. 2016;7( 27242098):11727.