Anti MAN2B1 pAb (ATL-HPA041530)

Atlas Antibodies

Catalog No.: ATL-HPA041530-25

Protein Description: mannosidase, alpha, class 2B, member 1
Gene Name: MAN2B1
Alternative Gene Name: LAMAN, MANB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005142: 77%, ENSRNOG00000023910: 80%
Entrez Gene ID: 4125
Uniprot ID: O00754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVN
• Gene Sequence: TGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVN
• Gene ID - Mouse: ENSMUSG00000005142
• Gene ID - Rat: ENSRNOG00000023910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.