Gene Name: MAIP1
Alternative Gene Name: C2orf47, DKFZp666A212, FLJ22555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025971: 88%, ENSRNOG00000015983: 86%
Entrez Gene ID: 79568
Uniprot ID: Q8WWC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV |
| Gene Sequence | FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV |
| Gene ID - Mouse | ENSMUSG00000025971 |
| Gene ID - Rat | ENSRNOG00000015983 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAIP1 pAb (ATL-HPA064013) | |
| Datasheet | Anti MAIP1 pAb (ATL-HPA064013) Datasheet (External Link) |
| Vendor Page | Anti MAIP1 pAb (ATL-HPA064013) at Atlas Antibodies |
| Documents & Links for Anti MAIP1 pAb (ATL-HPA064013) | |
| Datasheet | Anti MAIP1 pAb (ATL-HPA064013) Datasheet (External Link) |
| Vendor Page | Anti MAIP1 pAb (ATL-HPA064013) |