Anti MAIP1 pAb (ATL-HPA064013)

Atlas Antibodies

SKU: ATL-HPA064013-100

• 
• 

Protein Description: matrix AAA peptidase interacting protein 1
Gene Name: MAIP1
Alternative Gene Name: C2orf47, DKFZp666A212, FLJ22555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025971: 88%, ENSRNOG00000015983: 86%
Entrez Gene ID: 79568
Uniprot ID: Q8WWC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
• Gene Sequence: FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
• Gene ID - Mouse: ENSMUSG00000025971
• Gene ID - Rat: ENSRNOG00000015983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.