Anti LZTFL1 pAb (ATL-HPA043466 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043466-25

Protein Description: leucine zipper transcription factor-like 1
Gene Name: LZTFL1
Alternative Gene Name: BBS17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025245: 88%, ENSRNOG00000006244: 87%
Entrez Gene ID: 54585
Uniprot ID: Q9NQ48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLN
• Gene Sequence: NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLN
• Gene ID - Mouse: ENSMUSG00000025245
• Gene ID - Rat: ENSRNOG00000006244
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LZTFL1 pAb (ATL-HPA043466 w/enhanced validation) – 1 Found

Promchan, Kanyarat; Natarajan, Ven. Leucine zipper transcription factor-like 1 binds adaptor protein complex-1 and 2 and participates in trafficking of transferrin receptor 1. Plos One. 15(1):e0226298.